PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000364750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 99aa    MW: 11624.8 Da    PI: 5.0047
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000364750genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM576.7e-185197148
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
                   lppGfrFhPtdeel+++yLk +++++++++ ++i+evdiyk++Pw+Lp
  MDP0000364750 51 LPPGFRFHPTDEELIMFYLKYQATSRPCPV-SIIPEVDIYKFDPWELP 97
                   79****************************.89**************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.23E-214398IPR003441NAC domain
PROSITE profilePS5100521.9195199IPR003441NAC domain
PfamPF023658.3E-75291IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 99 aa     Download sequence    Send to blast
VSPLXLQPQN LIQAAAKQFS EFLIFFLFFX FFILFFSERA PKMEAKQSSQ LPPGFRFHPT  60
DEELIMFYLK YQATSRPCPV SIIPEVDIYK FDPWELPGX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-164497861Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.98591e-146fruit| leaf| stem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981271e-82KF198127.1 Malus hupehensis NAC domain protein (NAC120) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008361781.14e-33PREDICTED: NAC transcription factor 29-like
RefseqXP_008368238.14e-33PREDICTED: NAC transcription factor 29-like
SwissprotO492553e-26NAC29_ARATH; NAC transcription factor 29
TrEMBLD9ZJA95e-33D9ZJA9_MALDO; NAC domain class transcription factor
STRINGPGSC0003DMT4000474402e-28(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69490.12e-27NAC-like, activated by AP3/PI